Sermorelin Acetate Grf 1-29 Hormone CAS NO.86168-78-7
- FOB Price: USD: 1.00-2.00 /Metric Ton Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: T/T,Other
- Available Specifications:
1(1-10)Metric Ton2/Metric Ton1USD1(10-100)Metric Ton1/Metric Ton10USD2(1-10)Metric Ton1/Metric Ton1USD
- Product Details
Keywords
- Sermorelin Acetate
- Pharmaceutical intermediates
- Pharmaceutical intermediates
Quick Details
- ProName: Sermorelin Acetate Grf 1-29 Hormone
- CasNo: 86168-78-7
- Molecular Formula: C149H246N44O42S
- Appearance: detailed see specifications
- Application: Pharmaceutical Intermediates
- DeliveryTime: 3 business days after payment
- PackAge: foil bags, drums or bottles
- Port: CMP
- ProductionCapacity: 100 Metric Ton/Day
- Purity: ≥99%
- Storage: Store in dry, dark and ventilated plac...
- Transportation: By air - DHL, TNT,FEDEX,EMS...ETC. ...
- LimitNum: 1 Gram
- N/A: N/A
Superiority
lowest price,highest quality,shortest delivery!
1.Rich experience
We specialize in this filed for many years,our steriods and hormones exported to all over the world and established long friendly relations of coroperation with them.
2.Great quality,purity and favorable
Good quality is one of our biggest secert to success;u can get the best quality and service from us.
3.Safest and fastest delivery
We have adequate stock so that we can deliver the products with 24 hours as soon as receiving the payment.Fast and discreet shipment will be arranged to pass customs.
4.Good package
Unique ways to ship 10g to 100kg powders to your destination.We offer melting powder into liquid service and ship the liquid in special bottles.
5.Great after-sales service
Any questions or problems after receiving the product,pls feel free to contact us.Problems would be solved immediately.
General Comments:
We have professional team for package and shipment.Unique ways to ship 10g to 100kg powders at one time to your country.Our shipments are by EMS,DHL,TNT,FEDEX,HKEMS,UPS,etc for 25kg,between 25kg-200kg by air,over 200kg by sea.Fast and secure shipment could be arranged for customs pass guaranteed.
Our company has independent import and export authority,also has the certificate of importing and exporting pharmaceutical materials.At the same time we are developed manufactures with mass stock.
Details
-
Sermorelin Basic information Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 EINECS: Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors Mol File: 86168-78-7.mol Sermorelin Chemical Properties storage temp. −20°C CAS DataBase Reference 86168-78-7(CAS DataBase Reference) Safety Information WGK Germany 3 MSDS Information Provider Language SigmaAldrich English Sermorelin Usage And Synthesis Uses xanthine oxidase inhibitor Sermorelin Preparation Products And Raw materials